Lineage for d2g75d2 (2g75 D:109-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516956Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1516960Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1516986Domain d2g75d2: 2g75 D:109-211 [147093]
    Other proteins in same PDB: d2g75a1, d2g75a2, d2g75b1, d2g75c1, d2g75c2, d2g75d1
    automated match to d2dd8l2

Details for d2g75d2

PDB Entry: 2g75 (more details), 2.28 Å

PDB Description: Crystal Structure of anti-SARS m396 Antibody
PDB Compounds: (D:) IGG Light chain

SCOPe Domain Sequences for d2g75d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g75d2 b.1.1.2 (D:109-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseefqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d2g75d2:

Click to download the PDB-style file with coordinates for d2g75d2.
(The format of our PDB-style files is described here.)

Timeline for d2g75d2: