SCOPe 2.02: Domain d2g75d2: 2g75 D:109-211

Lineage for d2g75d2 (2g75 D:109-211)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d2g75d2: 2g75 D:109-211 [147093]
   Other proteins in same PDB: d2g75a1, d2g75a2, d2g75b1, d2g75c1, d2g75c2, d2g75d1
   automatically matched to 2DD8 L:109-213

Details for d2g75d2

PDB Entry: 2g75, 2.28 Å

PDB Description: Crystal Structure of anti-SARS m396 Antibody

PDB Compounds: (D:) IGG Light chain

SCOPe Domain Sequences for d2g75d2:

Sequence; same for both SEQRES and ATOM records:

>d2g75d2 b.1.1.2 (D:109-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseefqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d2g75d2:

• d2g75d2 first appeared in SCOP 1.75
  
• d2g75d2 appears in SCOPe 2.01
  
• d2g75d2 appears in SCOPe 2.03
  
• d2g75d2 appears in the current release, SCOPe 2.08