SCOPe 2.01: Domain d2g75d1: 2g75 D:3-108

Lineage for d2g75d1 (2g75 D:3-108)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d2g75d1: 2g75 D:3-108 [147092]
   Other proteins in same PDB: d2g75a1, d2g75a2, d2g75b2, d2g75c1, d2g75c2, d2g75d2
   automatically matched to 2DD8 L:3-108

Details for d2g75d1

PDB Entry: 2g75, 2.28 Å

PDB Description: Crystal Structure of anti-SARS m396 Antibody

PDB Compounds: (D:) IGG Light chain

SCOPe Domain Sequences for d2g75d1:

Sequence; same for both SEQRES and ATOM records:

>d2g75d1 b.1.1.1 (D:3-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
yeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlg

Timeline for d2g75d1:

• d2g75d1 first appeared in SCOP 1.75
  
• d2g75d1 appears in SCOPe 2.02
  
• d2g75d1 appears in the current release, SCOPe 2.08