Lineage for d2g75d1 (2g75 D:3-108)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783480Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 783561Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 783568Domain d2g75d1: 2g75 D:3-108 [147092]
    Other proteins in same PDB: d2g75a1, d2g75a2, d2g75b2, d2g75c1, d2g75c2, d2g75d2
    automatically matched to 2DD8 L:3-108

Details for d2g75d1

PDB Entry: 2g75 (more details), 2.28 Å

PDB Description: Crystal Structure of anti-SARS m396 Antibody
PDB Compounds: (D:) IGG Light chain

SCOP Domain Sequences for d2g75d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g75d1 b.1.1.1 (D:3-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
yeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlg

SCOP Domain Coordinates for d2g75d1:

Click to download the PDB-style file with coordinates for d2g75d1.
(The format of our PDB-style files is described here.)

Timeline for d2g75d1: