SCOP 1.75: Domain d2g5gx1: 2g5g X:9-263

Lineage for d2g5gx1 (2g5g X:9-263)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
   Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;

4. Superfamily c.150.1: EreA/ChaN-like [159501] (3 families)
   there are four conserved residues in the putative active site: two His and two Glu

5. Family c.150.1.1: ChaN-like [159502] (1 protein)
   Pfam PF04187; DUF399; Ferric uptake regulator CjrA

6. Protein Heme transport protein ChaN [159503] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [159504] (1 PDB entry)
   Uniprot Q0PBW2 27-281

8. Domain d2g5gx1: 2g5g X:9-263 [147084]
   complexed with hem

Details for d2g5gx1

PDB Entry: 2g5g, 1.9 Å

PDB Description: cofacial heme binding to chan of campylobacter jejuni

PDB Compounds: (X:) Putative lipoprotein

SCOP Domain Sequences for d2g5gx1:

Sequence; same for both SEQRES and ATOM records:

>d2g5gx1 c.150.1.1 (X:9-263) Heme transport protein ChaN {Campylobacter jejuni [TaxId: 197]}
plqenkdfyildthtqkkisfedmilellkadvillgekhdevkhkisqvmifnalegnl
ssqninfdvalemlasteqnhldkafknkktikaneltnalnwdkvwkwkdyeqfvnvvf
yskskilganlsrseitsiyngaqplkgyvsttnevkkqlfdiislshklnpeenkelld
klveiqqfkdrrmadvlvhhvnkvlllagsyhtskkigiplhiqdfksskkivvvnlsyg
eidlkdsdyvliykg

Timeline for d2g5gx1:

• d2g5gx1 is new in SCOP 1.75
  
• d2g5gx1 appears in SCOPe 2.01
  
• d2g5gx1 appears in the current release, SCOPe 2.08