Lineage for d2g5gx1 (2g5g X:9-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923721Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
    Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;
  4. 2923722Superfamily c.150.1: EreA/ChaN-like [159501] (3 families) (S)
    there are four conserved residues in the putative active site: two His and two Glu
  5. 2923723Family c.150.1.1: ChaN-like [159502] (1 protein)
    Pfam PF04187; DUF399; Ferric uptake regulator CjrA
  6. 2923724Protein Heme transport protein ChaN [159503] (1 species)
  7. 2923725Species Campylobacter jejuni [TaxId:197] [159504] (1 PDB entry)
    Uniprot Q0PBW2 27-281
  8. 2923726Domain d2g5gx1: 2g5g X:9-263 [147084]
    complexed with hem

Details for d2g5gx1

PDB Entry: 2g5g (more details), 1.9 Å

PDB Description: cofacial heme binding to chan of campylobacter jejuni
PDB Compounds: (X:) Putative lipoprotein

SCOPe Domain Sequences for d2g5gx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5gx1 c.150.1.1 (X:9-263) Heme transport protein ChaN {Campylobacter jejuni [TaxId: 197]}
plqenkdfyildthtqkkisfedmilellkadvillgekhdevkhkisqvmifnalegnl
ssqninfdvalemlasteqnhldkafknkktikaneltnalnwdkvwkwkdyeqfvnvvf
yskskilganlsrseitsiyngaqplkgyvsttnevkkqlfdiislshklnpeenkelld
klveiqqfkdrrmadvlvhhvnkvlllagsyhtskkigiplhiqdfksskkivvvnlsyg
eidlkdsdyvliykg

SCOPe Domain Coordinates for d2g5gx1:

Click to download the PDB-style file with coordinates for d2g5gx1.
(The format of our PDB-style files is described here.)

Timeline for d2g5gx1: