Lineage for d2g5da1 (2g5d A:40-441)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 804836Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 804837Superfamily b.52.1: Barwin-like endoglucanases [50685] (4 families) (S)
  5. 804862Family b.52.1.4: MLTA-like [159195] (1 protein)
    Pfam PF03562 and Pfam PF06725 cover the middle and C-terminal parts, respectively; contains large insert domain of the L25-like fold ((50714))
  6. 804863Protein Membrane-bound lytic murein transglycosylase A, MLTA [159196] (3 species)
  7. 804875Species Neisseria gonorrhoeae [TaxId:485] [159199] (2 PDB entries)
    Uniprot Q9L6H1 40-441
  8. 804876Domain d2g5da1: 2g5d A:40-441 [147083]

Details for d2g5da1

PDB Entry: 2g5d (more details), 1.95 Å

PDB Description: crystal structure of mlta from neisseria gonorrhoeae monoclinic form
PDB Compounds: (A:) gna33

SCOP Domain Sequences for d2g5da1:

Sequence, based on SEQRES records: (download)

>d2g5da1 b.52.1.4 (A:40-441) Membrane-bound lytic murein transglycosylase A, MLTA {Neisseria gonorrhoeae [TaxId: 485]}
pdrpagipdpagttvagggavytvvphlsmphwaaqdfakslqsfrlgcanlknrqgwqd
vcaqafqtpihsfqakrfferyftpwqvagngslagtvtgyyepvlkgdgrrterarfpi
ygipddfisvplpaglrggknlvrirqtgknsgtidnaggthtadlsrfpitarttaikg
rfegsrflpyhtrnqinggaldgkapilgyaedpvelffmhiqgsgrlktpsgkyirigy
adknehpyvsigrymadkgylklgqtsmqgikaymrqnpqrlaevlgqnpsyiffrelag
sggdgpvgalgtplmgeyagaidrhyitlgaplfvatahpvtrkalnrlimaqdtgsaik
gavrvdyfwgygdeagelagkqkttgyvwqllpngmkpeyrp

Sequence, based on observed residues (ATOM records): (download)

>d2g5da1 b.52.1.4 (A:40-441) Membrane-bound lytic murein transglycosylase A, MLTA {Neisseria gonorrhoeae [TaxId: 485]}
pdrpagipdpagttvagggavytvvphlsmphwaaqdfakslqsfrlgcanlknrqgwqd
vcaqafqtpihsfqakrfferyftpwqvagngslagtvtgyyepvlkgdgrrterarfpi
ygipddfisvplplvrirqtgknsgthtadlsrfpitarttaikgrfegsrflpyhtrnq
inggaldgkapilgyaedpvelffmhiqgsgrlktpsgkyirigyadknehpyvsigrym
adkgylklgqtsmqgikaymrqnpqrlaevlgqnpsyiffreldgpvgalgtplmgeyag
aidrhyitlgaplfvatahpvtrkalnrlimaqdtgsaikgavrvdyfwgygdeagelag
kqkttgyvwqllpngmkpeyrp

SCOP Domain Coordinates for d2g5da1:

Click to download the PDB-style file with coordinates for d2g5da1.
(The format of our PDB-style files is described here.)

Timeline for d2g5da1: