Lineage for d2g43b1 (2g43 B:12-124)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 893809Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 893810Superfamily g.44.1: RING/U-box [57850] (6 families) (S)
  5. 893898Family g.44.1.5: Zf-UBP [161204] (3 proteins)
    Pfam PF02148
  6. 893905Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)
  7. 893906Species Human (Homo sapiens) [TaxId:9606] [161208] (2 PDB entries)
    Uniprot P45974 169-285
  8. 893910Domain d2g43b1: 2g43 B:12-124 [147082]
    automatically matched to 2G43 A:8-124
    complexed with unx, zn

Details for d2g43b1

PDB Entry: 2g43 (more details), 2.09 Å

PDB Description: Structure of the ZNF UBP domain from deubiquitinating enzyme isopeptidase T (IsoT)
PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase 5

SCOP Domain Sequences for d2g43b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g43b1 g.44.1.5 (B:12-124) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlk

SCOP Domain Coordinates for d2g43b1:

Click to download the PDB-style file with coordinates for d2g43b1.
(The format of our PDB-style files is described here.)

Timeline for d2g43b1: