Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) |
Family c.52.1.33: YaeQ-like [159605] (2 proteins) Pfam PF07152; contains extra N- and C-terminal beta-structures forming additional five-stranded beta-sheet; retains the PD motif in the putative active site |
Protein Hypothetical protein XAC2396 [159606] (1 species) |
Species Xanthomonas axonopodis pv. citri [TaxId:92829] [159607] (1 PDB entry) Uniprot Q8PJY1 4-182 |
Domain d2g3wa1: 2g3w A:4-182 [147077] complexed with act |
PDB Entry: 2g3w (more details), 1.9 Å
SCOPe Domain Sequences for d2g3wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3wa1 c.52.1.33 (A:4-182) Hypothetical protein XAC2396 {Xanthomonas axonopodis pv. citri [TaxId: 92829]} tatvrraelqisdmdrgyyanhsltlaqhpsetderlmvrllafalfaddrlefgrglsn ddepdlwrrdytgdpdlwidlgqpdesrvrkacnrsreavvigyggqatetwwkkhanam gryrnlrvieldsqatealgaliqrgmrfdviiqdgevqmladhgsvtltpmvrqapae
Timeline for d2g3wa1: