SCOPe 2.06: Domain d2g3wa1: 2g3w A:4-182

Lineage for d2g3wa1 (2g3w A:4-182)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families)

5. Family c.52.1.33: YaeQ-like [159605] (2 proteins)
   Pfam PF07152; contains extra N- and C-terminal beta-structures forming additional five-stranded beta-sheet; retains the PD motif in the putative active site

6. Protein Hypothetical protein XAC2396 [159606] (1 species)

7. Species Xanthomonas axonopodis pv. citri [TaxId:92829] [159607] (1 PDB entry)
   Uniprot Q8PJY1 4-182

8. Domain d2g3wa1: 2g3w A:4-182 [147077]
   complexed with act

Details for d2g3wa1

PDB Entry: 2g3w, 1.9 Å

PDB Description: The Crystal Structure of YaeQ Protein from Xanthomonas axonopodis pv. citri

PDB Compounds: (A:) hypothetical protein XAC2396

SCOPe Domain Sequences for d2g3wa1:

Sequence; same for both SEQRES and ATOM records:

>d2g3wa1 c.52.1.33 (A:4-182) Hypothetical protein XAC2396 {Xanthomonas axonopodis pv. citri [TaxId: 92829]}
tatvrraelqisdmdrgyyanhsltlaqhpsetderlmvrllafalfaddrlefgrglsn
ddepdlwrrdytgdpdlwidlgqpdesrvrkacnrsreavvigyggqatetwwkkhanam
gryrnlrvieldsqatealgaliqrgmrfdviiqdgevqmladhgsvtltpmvrqapae

Timeline for d2g3wa1:

• d2g3wa1 first appeared in SCOP 1.75
  
• d2g3wa1 appears in SCOPe 2.05
  
• d2g3wa1 appears in SCOPe 2.07
  
• d2g3wa1 appears in the current release, SCOPe 2.08