Lineage for d2g13a1 (2g13 A:4-98)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562705Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2562735Protein Major carboxysome shell protein 1A, CsoS1A [143416] (1 species)
  7. 2562736Species Halothiobacillus neapolitanus [TaxId:927] [143417] (2 PDB entries)
    Uniprot P45689 5-97
  8. 2562738Domain d2g13a1: 2g13 A:4-98 [147072]
    complexed with so4

Details for d2g13a1

PDB Entry: 2g13 (more details), 1.61 Å

PDB Description: csos1a with sulfate ion
PDB Compounds: (A:) Major carboxysome shell protein 1A

SCOPe Domain Sequences for d2g13a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g13a1 d.58.56.1 (A:4-98) Major carboxysome shell protein 1A, CsoS1A {Halothiobacillus neapolitanus [TaxId: 927]}
vtgialgmietrglvpaieaadamtkaaevrlvgrqfvgggyvtvlvrgetgavnaavra
gadacervgdglvaahiiarvhsevenilpkapqa

SCOPe Domain Coordinates for d2g13a1:

Click to download the PDB-style file with coordinates for d2g13a1.
(The format of our PDB-style files is described here.)

Timeline for d2g13a1: