SCOP 1.75: Domain d2g0ia1: 2g0i A:1-111

Lineage for d2g0ia1 (2g0i A:1-111)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.64: eIF1-like [55158] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243

4. Superfamily d.64.2: TM1457-like [118010] (1 family)
   forms a homodimer via alpha-helical interface

5. Family d.64.2.1: TM1457-like [118011] (4 proteins)
   Pfam PF04327; DUF464

6. Protein Hypothetical protein Smu.848 [160434] (1 species)

7. Species Streptococcus mutans [TaxId:1309] [160435] (2 PDB entries)
   Uniprot Q8DUQ5 1-111

8. Domain d2g0ia1: 2g0i A:1-111 [147066]
   complexed with ca, peg

Details for d2g0ia1

PDB Entry: 2g0i, 1.85 Å

PDB Description: crystal structure of smu.848 from streptococcus mutans

PDB Compounds: (A:) hypothetical protein SMU.848

SCOP Domain Sequences for d2g0ia1:

Sequence, based on SEQRES records:

>d2g0ia1 d.64.2.1 (A:1-111) Hypothetical protein Smu.848 {Streptococcus mutans [TaxId: 1309]}
miqatfirrkgilesveltghagsgeygfdivcaavstlsmnlvnalevladctvslqmd
efdggymkidlsyitnksdekvqllfeafllgitnlaenspefvtakimtq

Sequence, based on observed residues (ATOM records):

>d2g0ia1 d.64.2.1 (A:1-111) Hypothetical protein Smu.848 {Streptococcus mutans [TaxId: 1309]}
miqatfirrkgilesveltghasgeygfdivcaavstlsmnlvnalevladctvslqmde
fdggymkidlsyitnksdekvqllfeafllgitnlaenspefvtakimtq

Timeline for d2g0ia1:

• d2g0ia1 is new in SCOP 1.75
  
• d2g0ia1 appears in SCOPe 2.01
  
• d2g0ia1 appears in the current release, SCOPe 2.08