SCOPe 2.08: Domain d2g0ed1: 2g0e D:2-72

Lineage for d2g0ed1 (2g0e D:2-72)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
Protein Multidrug binding protein QacR [68964] (1 species)
Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
Uniprot P23217
Domain d2g0ed1: 2g0e D:2-72 [147062]
Other proteins in same PDB: d2g0ea2, d2g0eb2, d2g0ed2, d2g0ee2
automated match to d1jt6b1
complexed with cgq, so4

Details for d2g0ed1

PDB Entry: 2g0e (more details), 2.88 Å

PDB Description: Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs

PDB Compounds: (D:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2g0ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g0ed1 a.4.1.9 (D:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d2g0ed1:

Click to download the PDB-style file with coordinates for d2g0ed1.
(The format of our PDB-style files is described here.)

Timeline for d2g0ed1: