Lineage for d2g0da_ (2g0d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004794Superfamily a.102.6: LanC-like [158745] (1 family) (S)
    comprises seven hairpins
    automatically mapped to Pfam PF05147
  5. 2004795Family a.102.6.1: LanC-like [158746] (1 protein)
    Pfam PF05147; there are seven internal sequence repeats
  6. 2004796Protein Nisin biosynthesis protein NisC [158747] (1 species)
  7. 2004797Species Lactococcus lactis [TaxId:1358] [158748] (2 PDB entries)
    Uniprot Q03202 7-415
  8. 2004798Domain d2g0da_: 2g0d A: [147057]
    automated match to d2g02a1
    complexed with zn

Details for d2g0da_

PDB Entry: 2g0d (more details), 2.21 Å

PDB Description: Nisin cyclase
PDB Compounds: (A:) Nisin biosynthesis protein nisC

SCOPe Domain Sequences for d2g0da_:

Sequence, based on SEQRES records: (download)

>d2g0da_ a.102.6.1 (A:) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]}
kknikrnvekiiaqwdertrknkenfdfgeltlstglpgiilmlaelknkdnskiyqkki
dnyieyivsklstyglltgslysgaagialsilhlreddekyknlldslnryieyfvrek
iegfnlenitppdydvieglsgilsylllindeqyddlkiliinflsnltkennglisly
iksenqmsqsesemyplgclnmglahglagvgcilayahikgysneaslsalqkiifiye
kfelerkkqflwkdglvadelkkekvireasfirdawcyggpgisllylygglaldndyf
vdkaekilesamqrklgidsymichgysglieicslfkrllntkkfdsymeefnvnseqi
leeygdesgtgflegisgcilvlskfeysinftywrqalllfddflkgg

Sequence, based on observed residues (ATOM records): (download)

>d2g0da_ a.102.6.1 (A:) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]}
kknikrnvekiiaqwdertrkdfgeltlstglpgiilmlaelknkdnskiyqkkidnyie
yivsklstyglltgslysgaagialsilhlreddekyknlldslnryieyfvrekiegfn
lenitppdydvieglsgilsylllindeqyddlkiliinflsnltkennglislyiksen
qmsqsesemyplgclnmglahglagvgcilayahikgysneaslsalqkiifiyekfele
rkkqflwkdglvadelkkekvireasfirdawcyggpgisllylygglaldndyfvdkae
kilesamqrklgidsymichgysglieicslfkrllntkkfdsymeefnvnseqileeyg
desgtgflegisgcilvlskfeysinftywrqalllfddflkgg

SCOPe Domain Coordinates for d2g0da_:

Click to download the PDB-style file with coordinates for d2g0da_.
(The format of our PDB-style files is described here.)

Timeline for d2g0da_: