Lineage for d2g02a1 (2g02 A:7-415)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004794Superfamily a.102.6: LanC-like [158745] (1 family) (S)
    comprises seven hairpins
    automatically mapped to Pfam PF05147
  5. 2004795Family a.102.6.1: LanC-like [158746] (1 protein)
    Pfam PF05147; there are seven internal sequence repeats
  6. 2004796Protein Nisin biosynthesis protein NisC [158747] (1 species)
  7. 2004797Species Lactococcus lactis [TaxId:1358] [158748] (2 PDB entries)
    Uniprot Q03202 7-415
  8. 2004799Domain d2g02a1: 2g02 A:7-415 [147056]
    complexed with zn

Details for d2g02a1

PDB Entry: 2g02 (more details), 2.5 Å

PDB Description: Nisin cyclase
PDB Compounds: (A:) Nisin biosynthesis protein nisC

SCOPe Domain Sequences for d2g02a1:

Sequence, based on SEQRES records: (download)

>d2g02a1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]}
kknikrnvekiiaqwdertrknkenfdfgeltlstglpgiilmlaelknkdnskiyqkki
dnyieyivsklstyglltgslysgaagialsilhlreddekyknlldslnryieyfvrek
iegfnlenitppdydvieglsgilsylllindeqyddlkiliinflsnltkennglisly
iksenqmsqsesemyplgclnmglahglagvgcilayahikgysneaslsalqkiifiye
kfelerkkqflwkdglvadelkkekvireasfirdawcyggpgisllylygglaldndyf
vdkaekilesamqrklgidsymichgysglieicslfkrllntkkfdsymeefnvnseqi
leeygdesgtgflegisgcilvlskfeysinftywrqalllfddflkgg

Sequence, based on observed residues (ATOM records): (download)

>d2g02a1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]}
kknikrnvekiiaqwdertrkdfgeltlstglpgiilmlaelknkdnskiyqkkidnyie
yivsklstyglltgslysgaagialsilhlreddekyknlldslnryieyfvrekiegfn
lenitppdydvieglsgilsylllindeqyddlkiliinflsnltkennglislyiksen
qmsqsesemyplgclnmglahglagvgcilayahikgysneaslsalqkiifiyekfele
rkkqflwkdglvadelkkekvireasfirdawcyggpgisllylygglaldndyfvdkae
kilesamqrklgidsymichgysglieicslfkrllntkkfdsymeefnvnseqileeyg
desgtgflegisgcilvlskfeysinftywrqalllfddflkgg

SCOPe Domain Coordinates for d2g02a1:

Click to download the PDB-style file with coordinates for d2g02a1.
(The format of our PDB-style files is described here.)

Timeline for d2g02a1: