SCOPe 2.08: Domain d2fzpa1: 2fzp A:193-317

Lineage for d2fzpa1 (2fzp A:193-317)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.345: NRDP1 C-terminal domain-like [160087] (1 superfamily)
   alpha-beta-alpha(3)-beta(3); a pseudo barrel beta-sheet of an SH3-like topology, surrounded by helices

4. Superfamily d.345.1: NRDP1 C-terminal domain-like [160088] (1 family)
   automatically mapped to Pfam PF08941

5. Family d.345.1.1: USP8 interacting domain [160089] (1 protein)
   Pfam PF08941

6. Protein E3 ubiquitin-protein ligase NRDP1 [160090] (1 species)
   RING finger protein 41

7. Species Human (Homo sapiens) [TaxId:9606] [160091] (3 PDB entries)
   Uniprot Q9H4P4 193-317! Uniprot Q9H4P4 197-317

8. Domain d2fzpa1: 2fzp A:193-317 [147055]
   Other proteins in same PDB: d2fzpa2

Details for d2fzpa1

PDB Entry: 2fzp, 1.87 Å

PDB Description: Crystal structure of the USP8 interaction domain of human NRDP1

PDB Compounds: (A:) ring finger protein 41 isoform 1

SCOPe Domain Sequences for d2fzpa1:

Sequence; same for both SEQRES and ATOM records:

>d2fzpa1 d.345.1.1 (A:193-317) E3 ubiquitin-protein ligase NRDP1 {Human (Homo sapiens) [TaxId: 9606]}
tieyneilewvnslqparvtrwggmistpdavlqavikrslvesgcpasivnelienahe
rswpqglatletrqmnrryyenyvakripgkqavvvmacenqhmgddmvqepglvmifah
gveei

Timeline for d2fzpa1:

• d2fzpa1 first appeared in SCOP 1.75
  
• d2fzpa1 appears in SCOPe 2.07