SCOP 1.75: Domain d2fy9b1: 2fy9 B:1-54

Lineage for d2fy9b1 (2fy9 B:1-54)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.3: AbrB N-terminal domain-like [54743] (2 proteins)
   dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ

6. Protein Putative transition state regulator ABH [159358] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159359] (1 PDB entry)
   Uniprot P39758 1-54

8. Domain d2fy9b1: 2fy9 B:1-54 [147053]
   automatically matched to 2FY9 A:1-54

Details for d2fy9b1

PDB Entry: 2fy9

PDB Description: solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abh

PDB Compounds: (B:) Putative transition state regulator abh

SCOP Domain Sequences for d2fy9b1:

Sequence; same for both SEQRES and ATOM records:

>d2fy9b1 b.129.1.3 (B:1-54) Putative transition state regulator ABH {Bacillus subtilis [TaxId: 1423]}
mksigvvrkvdelgrivmpielrraldiaikdsieffvdgdkiilkkykphgvc

Timeline for d2fy9b1:

• d2fy9b1 is new in SCOP 1.75
  
• d2fy9b1 appears in SCOPe 2.01
  
• d2fy9b1 appears in the current release, SCOPe 2.08, called d2fy9b_