SCOPe 2.07: Domain d2fxta1: 2fxt A:234-425

Lineage for d2fxta1 (2fxt A:234-425)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.13: TIM44-like [143001] (2 proteins)
   contains extra N-terminal helices but lacks the beta-hairpin in the superfamily-specific insertion
   automatically mapped to Pfam PF04280

6. Protein Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain [143002] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159984] (1 PDB entry)
   Uniprot Q01852 234-425

8. Domain d2fxta1: 2fxt A:234-425 [147051]

Details for d2fxta1

PDB Entry: 2fxt, 3.2 Å

PDB Description: crystal structure of yeast tim44

PDB Compounds: (A:) Import inner membrane translocase subunit TIM44

SCOPe Domain Sequences for d2fxta1:

Sequence; same for both SEQRES and ATOM records:

>d2fxta1 d.17.4.13 (A:234-425) Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
siqslknklwdesenplivvmrkitnkvggffaetessrvysqfklmdptfsnesftrhl
reyivpeileayvkgdvkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivs
akllapqdipvlvvgcraqeinlyrkkktgeiaagdeanilmssyamvftrdpeqiddde
tegwkilefvrg

Timeline for d2fxta1:

• d2fxta1 first appeared in SCOP 1.75
  
• d2fxta1 appears in SCOPe 2.06
  
• d2fxta1 appears in the current release, SCOPe 2.08