![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.13: TIM44-like [143001] (2 proteins) contains extra N-terminal helices but lacks the beta-hairpin in the superfamily-specific insertion automatically mapped to Pfam PF04280 |
![]() | Protein Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain [143002] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159984] (1 PDB entry) Uniprot Q01852 234-425 |
![]() | Domain d2fxta1: 2fxt A:234-425 [147051] |
PDB Entry: 2fxt (more details), 3.2 Å
SCOPe Domain Sequences for d2fxta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxta1 d.17.4.13 (A:234-425) Translocase of inner mitochondrial membrane TIMM44 (TIM44), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} siqslknklwdesenplivvmrkitnkvggffaetessrvysqfklmdptfsnesftrhl reyivpeileayvkgdvkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivs akllapqdipvlvvgcraqeinlyrkkktgeiaagdeanilmssyamvftrdpeqiddde tegwkilefvrg
Timeline for d2fxta1: