Lineage for d2fvna1 (2fvn A:2-122)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789904Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 789909Family b.2.3.2: Pilus subunits [49405] (8 proteins)
  6. 789916Protein Invasin AfaD [158928] (1 species)
  7. 789917Species Escherichia coli [TaxId:562] [158929] (3 PDB entries)
    Uniprot Q47038 27-147
  8. 789921Domain d2fvna1: 2fvn A:2-122 [147050]

Details for d2fvna1

PDB Entry: 2fvn (more details)

PDB Description: the fibrillar tip complex of the afa/dr adhesins from pathogen e. coli displays synergistic binding to 5 1 and v 3 integrins
PDB Compounds: (A:) Protein afaD

SCOP Domain Sequences for d2fvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fvna1 b.2.3.2 (A:2-122) Invasin AfaD {Escherichia coli [TaxId: 562]}
aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh
elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq
e

SCOP Domain Coordinates for d2fvna1:

Click to download the PDB-style file with coordinates for d2fvna1.
(The format of our PDB-style files is described here.)

Timeline for d2fvna1: