Lineage for d2fsua1 (2fsu A:12-194)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2898258Superfamily c.67.2: PhnH-like [159709] (1 family) (S)
    single domain protein of similar topology to the core domain of PLP-transferases
    automatically mapped to Pfam PF05845
  5. 2898259Family c.67.2.1: PhnH-like [159710] (2 proteins)
    Pfam PF05845; Bacterial phosphonate metabolism protein (PhnH)
  6. 2898260Protein Phosphonate metabolism protein PhnH [159711] (1 species)
  7. 2898261Species Escherichia coli [TaxId:562] [159712] (1 PDB entry)
    Uniprot P16686 12-194
  8. 2898262Domain d2fsua1: 2fsu A:12-194 [147048]
    complexed with act, na

Details for d2fsua1

PDB Entry: 2fsu (more details), 1.7 Å

PDB Description: crystal structure of the phnh protein from escherichia coli
PDB Compounds: (A:) Protein phnH

SCOPe Domain Sequences for d2fsua1:

Sequence, based on SEQRES records: (download)

>d2fsua1 c.67.2.1 (A:12-194) Phosphonate metabolism protein PhnH {Escherichia coli [TaxId: 562]}
qdaqhsfrrllkamsepgvivalhqlkrgwqplniattsvlltladndtpvwlstplnnd
ivnqslrfhtnaplvsqpeqatfavtdeaisseqlnalstgtavapeagatlilqvasls
ggrmlrltgagiaeermiapqlpecilhelterphpfplgidliltcgerllaiprtthv
evc

Sequence, based on observed residues (ATOM records): (download)

>d2fsua1 c.67.2.1 (A:12-194) Phosphonate metabolism protein PhnH {Escherichia coli [TaxId: 562]}
qdaqhsfrrllkamsepgvivalhqlkrgwqplniattsvlltladndtpvwlstplnnd
ivnqslrfhtnaplvsqpeqatfavtdeaisseqlnalsgatlilqvaslsggrmlrltg
eermiapqlpecilhelterphpfplgidliltcgerllaiprtthvevc

SCOPe Domain Coordinates for d2fsua1:

Click to download the PDB-style file with coordinates for d2fsua1.
(The format of our PDB-style files is described here.)

Timeline for d2fsua1: