![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.2: PhnH-like [159709] (1 family) ![]() single domain protein of similar topology to the core domain of PLP-transferases automatically mapped to Pfam PF05845 |
![]() | Family c.67.2.1: PhnH-like [159710] (2 proteins) Pfam PF05845; Bacterial phosphonate metabolism protein (PhnH) |
![]() | Protein Phosphonate metabolism protein PhnH [159711] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [159712] (1 PDB entry) Uniprot P16686 12-194 |
![]() | Domain d2fsua1: 2fsu A:12-194 [147048] complexed with act, na |
PDB Entry: 2fsu (more details), 1.7 Å
SCOPe Domain Sequences for d2fsua1:
Sequence, based on SEQRES records: (download)
>d2fsua1 c.67.2.1 (A:12-194) Phosphonate metabolism protein PhnH {Escherichia coli [TaxId: 562]} qdaqhsfrrllkamsepgvivalhqlkrgwqplniattsvlltladndtpvwlstplnnd ivnqslrfhtnaplvsqpeqatfavtdeaisseqlnalstgtavapeagatlilqvasls ggrmlrltgagiaeermiapqlpecilhelterphpfplgidliltcgerllaiprtthv evc
>d2fsua1 c.67.2.1 (A:12-194) Phosphonate metabolism protein PhnH {Escherichia coli [TaxId: 562]} qdaqhsfrrllkamsepgvivalhqlkrgwqplniattsvlltladndtpvwlstplnnd ivnqslrfhtnaplvsqpeqatfavtdeaisseqlnalsgatlilqvaslsggrmlrltg eermiapqlpecilhelterphpfplgidliltcgerllaiprtthvevc
Timeline for d2fsua1: