Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.378: Phosphoprotein oligomerization domain-like [160891] (1 superfamily) intertwinned homodimer of beta(2)-alpha-beta(2) motifs; 3 layers: b/a/b; each antiparallel beta-sheet is formed by the N-terminal beta-hairpin of one subunit and the C-terminal beta-hairpin of the other subunit; order 1243 |
Superfamily d.378.1: Phosphoprotein oligomerization domain-like [160892] (1 family) automatically mapped to Pfam PF00922 |
Family d.378.1.1: Phosphoprotein oligomerization domain-like [160893] (1 protein) middle part of Pfam PF00922 |
Protein Phosphoprotein P (M1) [160894] (1 species) |
Species Vesicular stomatitis indiana virus [TaxId:11277] [160895] (1 PDB entry) Uniprot P04880 107-171 |
Domain d2fqmd2: 2fqm D:107-177 [147045] Other proteins in same PDB: d2fqmd3, d2fqme3 automated match to d2fqma1 |
PDB Entry: 2fqm (more details), 2.3 Å
SCOPe Domain Sequences for d2fqmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fqmd2 d.378.1.1 (D:107-177) Phosphoprotein P (M1) {Vesicular stomatitis indiana virus [TaxId: 11277]} dwkqpelesdehgktlrltlpeglsgeqksqwmltikavvqsakhwnlaectfeasgegv iikkrqitpdv
Timeline for d2fqmd2: