SCOPe 2.08: Domain d2fqmd2: 2fqm D:107-177

Lineage for d2fqmd2 (2fqm D:107-177)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.378: Phosphoprotein oligomerization domain-like [160891] (1 superfamily)
   intertwinned homodimer of beta(2)-alpha-beta(2) motifs; 3 layers: b/a/b; each antiparallel beta-sheet is formed by the N-terminal beta-hairpin of one subunit and the C-terminal beta-hairpin of the other subunit; order 1243

4. Superfamily d.378.1: Phosphoprotein oligomerization domain-like [160892] (1 family)
   automatically mapped to Pfam PF00922

5. Family d.378.1.1: Phosphoprotein oligomerization domain-like [160893] (1 protein)
   middle part of Pfam PF00922

6. Protein Phosphoprotein P (M1) [160894] (1 species)

7. Species Vesicular stomatitis indiana virus [TaxId:11277] [160895] (1 PDB entry)
   Uniprot P04880 107-171

8. Domain d2fqmd2: 2fqm D:107-177 [147045]
   Other proteins in same PDB: d2fqmd3, d2fqme3
   automated match to d2fqma1

Details for d2fqmd2

PDB Entry: 2fqm, 2.3 Å

PDB Description: crystal structure of the oligomerization domain of the phosphoprotein of vesicular stomatitis virus

PDB Compounds: (D:) Phosphoprotein

SCOPe Domain Sequences for d2fqmd2:

Sequence; same for both SEQRES and ATOM records:

>d2fqmd2 d.378.1.1 (D:107-177) Phosphoprotein P (M1) {Vesicular stomatitis indiana virus [TaxId: 11277]}
dwkqpelesdehgktlrltlpeglsgeqksqwmltikavvqsakhwnlaectfeasgegv
iikkrqitpdv

Timeline for d2fqmd2:

• d2fqmd2 first appeared in SCOP 1.75, called d2fqmd1
  
• d2fqmd2 appears in SCOPe 2.07