Lineage for d2fqma1 (2fqm A:107-171)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 883110Fold d.378: Phosphoprotein oligomerization domain-like [160891] (1 superfamily)
    intertwinned homodimer of beta(2)-alpha-beta(2) motifs; 3 layers: b/a/b; each antiparallel beta-sheet is formed by the N-terminal beta-hairpin of one subunit and the C-terminal beta-hairpin of the other subunit; order 1243
  4. 883111Superfamily d.378.1: Phosphoprotein oligomerization domain-like [160892] (1 family) (S)
  5. 883112Family d.378.1.1: Phosphoprotein oligomerization domain-like [160893] (1 protein)
    middle part of Pfam PF00922
  6. 883113Protein Phosphoprotein P (M1) [160894] (1 species)
  7. 883114Species Vesicular stomatitis indiana virus [TaxId:11277] [160895] (1 PDB entry)
    Uniprot P04880 107-171
  8. 883115Domain d2fqma1: 2fqm A:107-171 [147042]
    mutant

Details for d2fqma1

PDB Entry: 2fqm (more details), 2.3 Å

PDB Description: crystal structure of the oligomerization domain of the phosphoprotein of vesicular stomatitis virus
PDB Compounds: (A:) Phosphoprotein

SCOP Domain Sequences for d2fqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fqma1 d.378.1.1 (A:107-171) Phosphoprotein P (M1) {Vesicular stomatitis indiana virus [TaxId: 11277]}
dwkqpelesdehgktlrltlpeglsgeqksqwmltikavvqsakhwnlaectfeasgegv
iikkr

SCOP Domain Coordinates for d2fqma1:

Click to download the PDB-style file with coordinates for d2fqma1.
(The format of our PDB-style files is described here.)

Timeline for d2fqma1: