Lineage for d2fhfa3 (2fhf A:32-162)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768717Family b.3.1.3: PUD-like [158932] (1 protein)
    Pfam PF03714; bacterial pullanase-associated domain
  6. 2768718Protein Pullulanase PulA [158933] (4 species)
  7. 2768719Species Klebsiella pneumoniae [TaxId:573] [158934] (3 PDB entries)
    Uniprot P07206 39-169
  8. 2768720Domain d2fhfa3: 2fhf A:32-162 [147037]
    Other proteins in same PDB: d2fhfa1, d2fhfa2, d2fhfa4, d2fhfa5
    complexed with ca

Details for d2fhfa3

PDB Entry: 2fhf (more details), 1.65 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltotetraose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhfa3 b.3.1.3 (A:32-162) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap
vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv
sviagnsavyd

SCOPe Domain Coordinates for d2fhfa3:

Click to download the PDB-style file with coordinates for d2fhfa3.
(The format of our PDB-style files is described here.)

Timeline for d2fhfa3: