SCOPe 2.01: Domain d2fhca4: 2fhc A:966-1083

Lineage for d2fhca4 (2fhc A:966-1083)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Pullulanase PulA [159262] (1 species)

7. Species Klebsiella pneumoniae [TaxId:573] [159263] (3 PDB entries)
   Uniprot P07206 973-1090

8. Domain d2fhca4: 2fhc A:966-1083 [147033]
   Other proteins in same PDB: d2fhca1, d2fhca2, d2fhca3, d2fhca5
   automatically matched to 2FHF A:966-1083
   complexed with ca

Details for d2fhca4

PDB Entry: 2fhc, 1.85 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltotriose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhca4:

Sequence; same for both SEQRES and ATOM records:

>d2fhca4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

Timeline for d2fhca4:

• d2fhca4 first appeared in SCOP 1.75
  
• d2fhca4 appears in SCOPe 2.02
  
• d2fhca4 appears in the current release, SCOPe 2.08