SCOPe 2.06: Domain d2fhca3: 2fhc A:32-162

Lineage for d2fhca3 (2fhc A:32-162)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.3: PUD-like [158932] (1 protein)
   Pfam PF03714; bacterial pullanase-associated domain

6. Protein Pullulanase PulA [158933] (4 species)

7. Species Klebsiella pneumoniae [TaxId:573] [158934] (3 PDB entries)
   Uniprot P07206 39-169

8. Domain d2fhca3: 2fhc A:32-162 [147032]
   Other proteins in same PDB: d2fhca1, d2fhca2, d2fhca4, d2fhca5
   automated match to d2fhfa3
   complexed with ca

Details for d2fhca3

PDB Entry: 2fhc, 1.85 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltotriose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhca3:

Sequence; same for both SEQRES and ATOM records:

>d2fhca3 b.3.1.3 (A:32-162) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap
vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv
sviagnsavyd

Timeline for d2fhca3:

• d2fhca3 first appeared in SCOP 1.75
  
• d2fhca3 appears in SCOPe 2.05
  
• d2fhca3 appears in SCOPe 2.07
  
• d2fhca3 appears in the current release, SCOPe 2.08