Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) |
Family b.3.1.3: PUD-like [158932] (1 protein) Pfam PF03714; bacterial pullanase-associated domain |
Protein Pullulanase PulA [158933] (4 species) |
Species Klebsiella pneumoniae [TaxId:573] [158934] (3 PDB entries) Uniprot P07206 39-169 |
Domain d2fhca3: 2fhc A:32-162 [147032] Other proteins in same PDB: d2fhca1, d2fhca2, d2fhca4, d2fhca5 automatically matched to 2FHF A:32-162 complexed with ca, glc; mutant |
PDB Entry: 2fhc (more details), 1.85 Å
SCOP Domain Sequences for d2fhca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhca3 b.3.1.3 (A:32-162) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv sviagnsavyd
Timeline for d2fhca3:
View in 3D Domains from same chain: (mouse over for more information) d2fhca1, d2fhca2, d2fhca4, d2fhca5 |