Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Pullulanase PulA [158883] (1 species) contains two E-set domains in tandem |
Species Klebsiella pneumoniae [TaxId:573] [158884] (3 PDB entries) Uniprot P07206 170-294! Uniprot P07206 295-409 |
Domain d2fhca2: 2fhc A:163-287 [147031] Other proteins in same PDB: d2fhca3, d2fhca4, d2fhca5 automatically matched to 2FHF A:163-287 complexed with ca |
PDB Entry: 2fhc (more details), 1.85 Å
SCOPe Domain Sequences for d2fhca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhca2 b.1.18.2 (A:163-287) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} sradafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvk ltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqtag vlddt
Timeline for d2fhca2:
View in 3D Domains from same chain: (mouse over for more information) d2fhca1, d2fhca3, d2fhca4, d2fhca5 |