![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Pullulanase PulA [159262] (1 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries) Uniprot P07206 973-1090 |
![]() | Domain d2fhba4: 2fhb A:966-1083 [147028] Other proteins in same PDB: d2fhba1, d2fhba2, d2fhba3, d2fhba5 automated match to d2fhfa4 complexed with ca, glc |
PDB Entry: 2fhb (more details), 1.8 Å
SCOPe Domain Sequences for d2fhba4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhba4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk
Timeline for d2fhba4:
![]() Domains from same chain: (mouse over for more information) d2fhba1, d2fhba2, d2fhba3, d2fhba5 |