Lineage for d2fhba4 (2fhb A:966-1083)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400744Protein Pullulanase PulA [159262] (1 species)
  7. 2400745Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries)
    Uniprot P07206 973-1090
  8. 2400749Domain d2fhba4: 2fhb A:966-1083 [147028]
    Other proteins in same PDB: d2fhba1, d2fhba2, d2fhba3, d2fhba5
    automated match to d2fhfa4
    complexed with ca, glc

Details for d2fhba4

PDB Entry: 2fhb (more details), 1.8 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhba4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhba4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf
agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk

SCOPe Domain Coordinates for d2fhba4:

Click to download the PDB-style file with coordinates for d2fhba4.
(The format of our PDB-style files is described here.)

Timeline for d2fhba4: