| Class b: All beta proteins [48724] (178 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
| Family b.3.1.3: PUD-like [158932] (1 protein) Pfam PF03714; bacterial pullanase-associated domain |
| Protein Pullulanase PulA [158933] (4 species) |
| Species Klebsiella pneumoniae [TaxId:573] [158934] (3 PDB entries) Uniprot P07206 39-169 |
| Domain d2fhba3: 2fhb A:32-162 [147027] Other proteins in same PDB: d2fhba1, d2fhba2, d2fhba4, d2fhba5 automated match to d2fhfa3 complexed with ca, glc |
PDB Entry: 2fhb (more details), 1.8 Å
SCOPe Domain Sequences for d2fhba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhba3 b.3.1.3 (A:32-162) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap
vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv
sviagnsavyd
Timeline for d2fhba3:
View in 3DDomains from same chain: (mouse over for more information) d2fhba1, d2fhba2, d2fhba4, d2fhba5 |