![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Pullulanase PulA [158883] (1 species) contains two E-set domains in tandem |
![]() | Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries) Uniprot P07206 170-294! Uniprot P07206 295-409 |
![]() | Domain d2fhba1: 2fhb A:288-402 [147025] Other proteins in same PDB: d2fhba3, d2fhba4, d2fhba5 automated match to d2fhfa1 complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2fhb (more details), 1.8 Å
SCOPe Domain Sequences for d2fhba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhba1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk
Timeline for d2fhba1:
![]() Domains from same chain: (mouse over for more information) d2fhba2, d2fhba3, d2fhba4, d2fhba5 |