Lineage for d2fhba1 (2fhb A:288-402)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765416Protein Pullulanase PulA [158883] (1 species)
    contains two E-set domains in tandem
  7. 2765417Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries)
    Uniprot P07206 170-294! Uniprot P07206 295-409
  8. 2765424Domain d2fhba1: 2fhb A:288-402 [147025]
    Other proteins in same PDB: d2fhba3, d2fhba4, d2fhba5
    automated match to d2fhfa1
    complexed with ca

    has additional insertions and/or extensions that are not grouped together

Details for d2fhba1

PDB Entry: 2fhb (more details), 1.8 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose
PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhba1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq
ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk

SCOPe Domain Coordinates for d2fhba1:

Click to download the PDB-style file with coordinates for d2fhba1.
(The format of our PDB-style files is described here.)

Timeline for d2fhba1: