Lineage for d2fe0a1 (2fe0 A:2-131)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433443Fold b.134: Smp-1-like [101600] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key/jelly-roll
  4. 2433444Superfamily b.134.1: Smp-1-like [101601] (1 family) (S)
  5. 2433445Family b.134.1.1: Smp-1-like [101602] (2 proteins)
  6. 2433446Protein Small myristoylated protein 1, Smp-1 [158971] (1 species)
  7. 2433447Species Leishmania major [TaxId:5664] [158972] (1 PDB entry)
    Uniprot Q5SDH5 1-131
  8. 2433448Domain d2fe0a1: 2fe0 A:2-131 [147024]
    Other proteins in same PDB: d2fe0a2

Details for d2fe0a1

PDB Entry: 2fe0 (more details)

PDB Description: nmr structure of smp-1 (small myristoylated protein) from leishmania major
PDB Compounds: (A:) small myristoylated protein 1

SCOPe Domain Sequences for d2fe0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fe0a1 b.134.1.1 (A:2-131) Small myristoylated protein 1, Smp-1 {Leishmania major [TaxId: 5664]}
gcgassenssvtyvngrptfvgeevtkgfekdngllfrivnkkkkqwayyndttqyemhv
lvtfnedcdikalgktkleqqengewvasvvvypcetemfiegrvngfkskmdalplsee
yrqhqaekdk

SCOPe Domain Coordinates for d2fe0a1:

Click to download the PDB-style file with coordinates for d2fe0a1.
(The format of our PDB-style files is described here.)

Timeline for d2fe0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fe0a2