SCOPe 2.08: Domain d2fe0a1: 2fe0 A:2-131

Lineage for d2fe0a1 (2fe0 A:2-131)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.134: Smp-1-like [101600] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key/jelly-roll

4. Superfamily b.134.1: Smp-1-like [101601] (1 family)

5. Family b.134.1.1: Smp-1-like [101602] (2 proteins)

6. Protein Small myristoylated protein 1, Smp-1 [158971] (1 species)

7. Species Leishmania major [TaxId:5664] [158972] (1 PDB entry)
   Uniprot Q5SDH5 1-131

8. Domain d2fe0a1: 2fe0 A:2-131 [147024]
   Other proteins in same PDB: d2fe0a2

Details for d2fe0a1

PDB Entry: 2fe0

PDB Description: nmr structure of smp-1 (small myristoylated protein) from leishmania major

PDB Compounds: (A:) small myristoylated protein 1

SCOPe Domain Sequences for d2fe0a1:

Sequence; same for both SEQRES and ATOM records:

>d2fe0a1 b.134.1.1 (A:2-131) Small myristoylated protein 1, Smp-1 {Leishmania major [TaxId: 5664]}
gcgassenssvtyvngrptfvgeevtkgfekdngllfrivnkkkkqwayyndttqyemhv
lvtfnedcdikalgktkleqqengewvasvvvypcetemfiegrvngfkskmdalplsee
yrqhqaekdk

Timeline for d2fe0a1:

• d2fe0a1 first appeared in SCOP 1.75
  
• d2fe0a1 appears in SCOPe 2.07