Lineage for d2fc7a1 (2fc7 A:8-76)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037668Family g.44.1.6: ZZ domain [161211] (4 proteins)
    Pfam PF00569
  6. 3037675Protein Zinc finger ZZ-type-containing protein 3, ZZZ3 [161216] (1 species)
  7. 3037676Species Human (Homo sapiens) [TaxId:9606] [161217] (1 PDB entry)
    Uniprot Q8IYR1 313-381
  8. 3037677Domain d2fc7a1: 2fc7 A:8-76 [147021]
    Other proteins in same PDB: d2fc7a2, d2fc7a3
    complexed with zn

Details for d2fc7a1

PDB Entry: 2fc7 (more details)

PDB Description: solution structure of the zz domain of zzz3 protein
PDB Compounds: (A:) ZZZ3 protein

SCOPe Domain Sequences for d2fc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]}
qqmqaesgfvqhvgfkcdncgiepiqgvrwhcqdcppemsldfcdscsdclhetdihked
hqlepiyrs

SCOPe Domain Coordinates for d2fc7a1:

Click to download the PDB-style file with coordinates for d2fc7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fc7a1: