Lineage for d2fc6a1 (2fc6 A:8-44)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967704Fold g.66: CCCH zinc finger [90228] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1967705Superfamily g.66.1: CCCH zinc finger [90229] (1 family) (S)
  5. 1967706Family g.66.1.1: CCCH zinc finger [90230] (4 proteins)
    C-x8-C-x5-C-x3-H type and similar
  6. 1967711Protein Target of EGR1 protein 1, TOE1 [161226] (1 species)
  7. 1967712Species Human (Homo sapiens) [TaxId:9606] [161227] (1 PDB entry)
    Uniprot Q96GM8 285-321
  8. 1967713Domain d2fc6a1: 2fc6 A:8-44 [147020]
    complexed with zn

Details for d2fc6a1

PDB Entry: 2fc6 (more details)

PDB Description: solution structure of the zf-ccch domain of target of egr1, member 1 (nuclear)
PDB Compounds: (A:) target of EGR1, member 1

SCOPe Domain Sequences for d2fc6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]}
cclppathrphptsicdnfsaygwcplgpqcpqshdi

SCOPe Domain Coordinates for d2fc6a1:

Click to download the PDB-style file with coordinates for d2fc6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fc6a1: