![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.66: CCCH zinc finger [90228] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.66.1: CCCH zinc finger [90229] (2 families) ![]() |
![]() | Family g.66.1.1: CCCH zinc finger [90230] (4 proteins) C-x8-C-x5-C-x3-H type and similar |
![]() | Protein Target of EGR1 protein 1, TOE1 [161226] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161227] (1 PDB entry) Uniprot Q96GM8 285-321 |
![]() | Domain d2fc6a1: 2fc6 A:8-44 [147020] Other proteins in same PDB: d2fc6a2, d2fc6a3 complexed with zn |
PDB Entry: 2fc6 (more details)
SCOPe Domain Sequences for d2fc6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} cclppathrphptsicdnfsaygwcplgpqcpqshdi
Timeline for d2fc6a1: