Lineage for d2fatl2 (2fat L:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752387Domain d2fatl2: 2fat L:107-213 [147018]
    Other proteins in same PDB: d2fath_, d2fatl1
    automated match to d1h3pl2

Details for d2fatl2

PDB Entry: 2fat (more details), 1.77 Å

PDB Description: An anti-urokinase plasminogen activator receptor (UPAR) antibody: Crystal structure and binding epitope
PDB Compounds: (L:) FAB ATN-615, light chain

SCOPe Domain Sequences for d2fatl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fatl2 b.1.1.2 (L:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d2fatl2:

Click to download the PDB-style file with coordinates for d2fatl2.
(The format of our PDB-style files is described here.)

Timeline for d2fatl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fatl1
View in 3D
Domains from other chains:
(mouse over for more information)
d2fath_