Lineage for d2fatl1 (2fat L:1-106A)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1104358Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104931Species Mouse (Mus musculus), cluster 3.4 [TaxId:10090] [88530] (6 PDB entries)
  8. 1104933Domain d2fatl1: 2fat L:1-106A [147017]
    Other proteins in same PDB: d2fath1, d2fath2, d2fatl2
    automatically matched to 2FD6 L:1-106A

Details for d2fatl1

PDB Entry: 2fat (more details), 1.77 Å

PDB Description: An anti-urokinase plasminogen activator receptor (UPAR) antibody: Crystal structure and binding epitope
PDB Compounds: (L:) FAB ATN-615, light chain

SCOPe Domain Sequences for d2fatl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fatl1 b.1.1.1 (L:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.4 [TaxId: 10090]}
divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleik

SCOPe Domain Coordinates for d2fatl1:

Click to download the PDB-style file with coordinates for d2fatl1.
(The format of our PDB-style files is described here.)

Timeline for d2fatl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fatl2