Lineage for d2f99d2 (2f99 D:2-143)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936941Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)
  6. 2936961Protein automated matches [190405] (1 species)
    not a true protein
  7. 2936962Species Streptomyces galilaeus [TaxId:33899] [187283] (2 PDB entries)
  8. 2936966Domain d2f99d2: 2f99 D:2-143 [147014]
    Other proteins in same PDB: d2f99a3, d2f99b3, d2f99d3
    automated match to d1sjwa_
    complexed with akv, so4

Details for d2f99d2

PDB Entry: 2f99 (more details), 1.9 Å

PDB Description: Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
PDB Compounds: (D:) Aklanonic Acid methyl Ester Cyclase, AknH

SCOPe Domain Sequences for d2f99d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f99d2 d.17.4.9 (D:2-143) automated matches {Streptomyces galilaeus [TaxId: 33899]}
seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse
earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd
wpdyqgtyrqlgepwpetehrr

SCOPe Domain Coordinates for d2f99d2:

Click to download the PDB-style file with coordinates for d2f99d2.
(The format of our PDB-style files is described here.)

Timeline for d2f99d2: