SCOPe 2.08: Domain d2f99d2: 2f99 D:2-143

Lineage for d2f99d2 (2f99 D:2-143)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)

6. Protein automated matches [190405] (1 species)
   not a true protein

7. Species Streptomyces galilaeus [TaxId:33899] [187283] (2 PDB entries)

8. Domain d2f99d2: 2f99 D:2-143 [147014]
   Other proteins in same PDB: d2f99a3, d2f99b3, d2f99d3
   automated match to d1sjwa_
   complexed with akv, so4

Details for d2f99d2

PDB Entry: 2f99, 1.9 Å

PDB Description: Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.

PDB Compounds: (D:) Aklanonic Acid methyl Ester Cyclase, AknH

SCOPe Domain Sequences for d2f99d2:

Sequence; same for both SEQRES and ATOM records:

>d2f99d2 d.17.4.9 (D:2-143) automated matches {Streptomyces galilaeus [TaxId: 33899]}
seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse
earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd
wpdyqgtyrqlgepwpetehrr

Timeline for d2f99d2:

• d2f99d2 first appeared in SCOP 1.75, called d2f99d1
  
• d2f99d2 appears in SCOPe 2.07