![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins) |
![]() | Protein automated matches [190405] (1 species) not a true protein |
![]() | Species Streptomyces galilaeus [TaxId:33899] [187283] (2 PDB entries) |
![]() | Domain d2f99b2: 2f99 B:2-141 [147012] Other proteins in same PDB: d2f99a3, d2f99b3, d2f99d3 automated match to d1sjwa_ complexed with akv, so4 |
PDB Entry: 2f99 (more details), 1.9 Å
SCOPe Domain Sequences for d2f99b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f99b2 d.17.4.9 (B:2-141) automated matches {Streptomyces galilaeus [TaxId: 33899]} seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd wpdyqgtyrqlgepwpeteh
Timeline for d2f99b2: