SCOP 1.75: Domain d2f99b1: 2f99 B:2-141

Lineage for d2f99b1 (2f99 B:2-141)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (30 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (5 proteins)

6. Protein Aklanonic acid methyl ester cyclase, AknH [159965] (1 species)

7. Species Streptomyces galilaeus [TaxId:33899] [159966] (2 PDB entries)
   Uniprot O52646 2-141

8. Domain d2f99b1: 2f99 B:2-141 [147012]
   automatically matched to 2F98 A:2-141
   complexed with akv, so4

Details for d2f99b1

PDB Entry: 2f99, 1.9 Å

PDB Description: Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.

PDB Compounds: (B:) Aklanonic Acid methyl Ester Cyclase, AknH

SCOP Domain Sequences for d2f99b1:

Sequence; same for both SEQRES and ATOM records:

>d2f99b1 d.17.4.9 (B:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]}
seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse
earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd
wpdyqgtyrqlgepwpeteh

Timeline for d2f99b1:

• d2f99b1 is new in SCOP 1.75
  
• d2f99b1 is called d2f99b_ in SCOPe 2.01
  
• d2f99b1 appears in the current release, SCOPe 2.08, called d2f99b2