Lineage for d2f99b1 (2f99 B:2-141)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 855951Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (5 proteins)
  6. 855952Protein Aklanonic acid methyl ester cyclase, AknH [159965] (1 species)
  7. 855953Species Streptomyces galilaeus [TaxId:33899] [159966] (2 PDB entries)
    Uniprot O52646 2-141
  8. 855955Domain d2f99b1: 2f99 B:2-141 [147012]
    automatically matched to 2F98 A:2-141
    complexed with akv, so4

Details for d2f99b1

PDB Entry: 2f99 (more details), 1.9 Å

PDB Description: Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
PDB Compounds: (B:) Aklanonic Acid methyl Ester Cyclase, AknH

SCOP Domain Sequences for d2f99b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f99b1 d.17.4.9 (B:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]}
seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse
earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd
wpdyqgtyrqlgepwpeteh

SCOP Domain Coordinates for d2f99b1:

Click to download the PDB-style file with coordinates for d2f99b1.
(The format of our PDB-style files is described here.)

Timeline for d2f99b1: