SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2f99a2 (2f99 A:2-141)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162510Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 protein domains)
  6. 2162530Protein automated matches [190405] (1 species)
    not a true protein
  7. 2162531Species Streptomyces galilaeus [TaxId:33899] [187283] (2 PDB entries)
  8. 2162532Domain d2f99a2: 2f99 A:2-141 [147011]
    Other proteins in same PDB: d2f99a3, d2f99b3, d2f99d3
    automated match to d1sjwa_
    complexed with akv, so4

Details for d2f99a2

PDB Entry: 2f99 (more details), 1.9 Å

PDB Description: Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
PDB Compounds: (A:) Aklanonic Acid methyl Ester Cyclase, AknH

SCOPe Domain Sequences for d2f99a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f99a2 d.17.4.9 (A:2-141) automated matches {Streptomyces galilaeus [TaxId: 33899]}
seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse
earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd
wpdyqgtyrqlgepwpeteh

SCOPe Domain Coordinates for d2f99a2:

Click to download the PDB-style file with coordinates for d2f99a2.
(The format of our PDB-style files is described here.)

Timeline for d2f99a2: