Lineage for d2f98d_ (2f98 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544019Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)
  6. 2544039Protein automated matches [190405] (1 species)
    not a true protein
  7. 2544040Species Streptomyces galilaeus [TaxId:33899] [187283] (2 PDB entries)
  8. 2544047Domain d2f98d_: 2f98 D: [147010]
    Other proteins in same PDB: d2f98a1, d2f98a2, d2f98b3, d2f98c3
    automated match to d1sjwa_
    complexed with ngv, so4

Details for d2f98d_

PDB Entry: 2f98 (more details), 2.1 Å

PDB Description: Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.
PDB Compounds: (D:) Aklanonic Acid methyl Ester Cyclase, AknH

SCOPe Domain Sequences for d2f98d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f98d_ d.17.4.9 (D:) automated matches {Streptomyces galilaeus [TaxId: 33899]}
seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse
earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd
wpdyqgtyrqlgepwpeteh

SCOPe Domain Coordinates for d2f98d_:

Click to download the PDB-style file with coordinates for d2f98d_.
(The format of our PDB-style files is described here.)

Timeline for d2f98d_: