Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins) |
Protein automated matches [190405] (1 species) not a true protein |
Species Streptomyces galilaeus [TaxId:33899] [187283] (2 PDB entries) |
Domain d2f98d_: 2f98 D: [147010] Other proteins in same PDB: d2f98a1, d2f98a2, d2f98b3, d2f98c3 automated match to d1sjwa_ complexed with ngv, so4 |
PDB Entry: 2f98 (more details), 2.1 Å
SCOPe Domain Sequences for d2f98d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f98d_ d.17.4.9 (D:) automated matches {Streptomyces galilaeus [TaxId: 33899]} seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd wpdyqgtyrqlgepwpeteh
Timeline for d2f98d_: