Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins) |
Protein Aklanonic acid methyl ester cyclase, AknH [159965] (1 species) |
Species Streptomyces galilaeus [TaxId:33899] [159966] (1 PDB entry) Uniprot O52646 2-141 |
Domain d2f98a1: 2f98 A:2-141 [147007] Other proteins in same PDB: d2f98b_, d2f98c_, d2f98d_ complexed with ngv, so4 |
PDB Entry: 2f98 (more details), 2.1 Å
SCOPe Domain Sequences for d2f98a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f98a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd wpdyqgtyrqlgepwpeteh
Timeline for d2f98a1: