SCOP 1.75: Domain d2f98a1: 2f98 A:2-141

Lineage for d2f98a1 (2f98 A:2-141)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (30 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (5 proteins)

6. Protein Aklanonic acid methyl ester cyclase, AknH [159965] (1 species)

7. Species Streptomyces galilaeus [TaxId:33899] [159966] (2 PDB entries)
   Uniprot O52646 2-141

8. Domain d2f98a1: 2f98 A:2-141 [147007]
   complexed with ngv, so4

Details for d2f98a1

PDB Entry: 2f98, 2.1 Å

PDB Description: Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity.

PDB Compounds: (A:) Aklanonic Acid methyl Ester Cyclase, AknH

SCOP Domain Sequences for d2f98a1:

Sequence; same for both SEQRES and ATOM records:

>d2f98a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]}
seqiaavrrmveayntgktddvadyihpeymnpgtleftslrgpelfainvawvkktfse
earleevgieeradwvrarlvlygrhvgemvgmaptgrlfsgeqihllhfvdgkihhhrd
wpdyqgtyrqlgepwpeteh

Timeline for d2f98a1:

• d2f98a1 is new in SCOP 1.75
  
• d2f98a1 appears in SCOPe 2.01
  
• d2f98a1 appears in the current release, SCOPe 2.08