Lineage for d2f8bb2 (2f8b B:5-56)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2265327Fold g.91: E7 C-terminal domain-like [161233] (1 superfamily)
    alpha+beta zinc-binding domain; beta(2)-alpha(2)
  4. 2265328Superfamily g.91.1: E7 C-terminal domain-like [161234] (1 family) (S)
    automatically mapped to Pfam PF00527
  5. 2265329Family g.91.1.1: E7 C-terminal domain-like [161235] (1 protein)
    C-terminal part of Pfam PF00527
  6. 2265330Protein E7 oncoprotein [161236] (2 species)
  7. 2265334Species Human papillomavirus type 45 [TaxId:10593] [161237] (2 PDB entries)
    Uniprot P21736 55-106
  8. 2265337Domain d2f8bb2: 2f8b B:5-56 [147006]
    Other proteins in same PDB: d2f8ba3, d2f8bb3
    automated match to d2ewla1
    complexed with zn

Details for d2f8bb2

PDB Entry: 2f8b (more details)

PDB Description: nmr structure of the c-terminal domain (dimer) of hpv45 oncoprotein e7
PDB Compounds: (B:) Protein E7

SCOPe Domain Sequences for d2f8bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8bb2 g.91.1.1 (B:5-56) E7 oncoprotein {Human papillomavirus type 45 [TaxId: 10593]}
aepqrhkilcvcckcdgrieltvessaedlrtlqqlflstlsfvcpwcatnq

SCOPe Domain Coordinates for d2f8bb2:

Click to download the PDB-style file with coordinates for d2f8bb2.
(The format of our PDB-style files is described here.)

Timeline for d2f8bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f8bb3