SCOPe 2.01: Domain d2f8bb1: 2f8b B:5-56

Lineage for d2f8bb1 (2f8b B:5-56)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.91: E7 C-terminal domain-like [161233] (1 superfamily)
   alpha+beta zinc-binding domain; beta(2)-alpha(2)

4. Superfamily g.91.1: E7 C-terminal domain-like [161234] (1 family)

5. Family g.91.1.1: E7 C-terminal domain-like [161235] (1 protein)
   C-terminal part of Pfam PF00527

6. Protein E7 oncoprotein [161236] (2 species)

7. Species Human papillomavirus type 45 [TaxId:10593] [161237] (2 PDB entries)
   Uniprot P21736 55-106

8. Domain d2f8bb1: 2f8b B:5-56 [147006]
   automatically matched to 2EWL A:5-56
   complexed with zn

Details for d2f8bb1

PDB Entry: 2f8b

PDB Description: nmr structure of the c-terminal domain (dimer) of hpv45 oncoprotein e7

PDB Compounds: (B:) Protein E7

SCOPe Domain Sequences for d2f8bb1:

Sequence; same for both SEQRES and ATOM records:

>d2f8bb1 g.91.1.1 (B:5-56) E7 oncoprotein {Human papillomavirus type 45 [TaxId: 10593]}
aepqrhkilcvcckcdgrieltvessaedlrtlqqlflstlsfvcpwcatnq

Timeline for d2f8bb1:

• d2f8bb1 first appeared in SCOP 1.75
  
• d2f8bb1 appears in SCOPe 2.02
  
• d2f8bb1 appears in the current release, SCOPe 2.08, called d2f8bb2