Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (21 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187281] (2 PDB entries) |
Domain d2f86h_: 2f86 H: [147001] Other proteins in same PDB: d2f86b1 automated match to d1hkxd_ |
PDB Entry: 2f86 (more details), 2.64 Å
SCOPe Domain Sequences for d2f86h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f86h_ d.17.4.0 (H:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ndsekaqkqdivrvtqtlldaisckdfetytrlcdtsmtcfepealgnliegiefhrfyf dgnrknqvhttmlnpnvhiigedaacvayvkltqfldrngeahtrqsqesrvwskkqgrw vcvhvhrst
Timeline for d2f86h_: