Lineage for d2f86d_ (2f86 D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405776Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1405777Protein automated matches [190205] (13 species)
    not a true protein
  7. 1405803Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187281] (2 PDB entries)
  8. 1405805Domain d2f86d_: 2f86 D: [146999]
    Other proteins in same PDB: d2f86b1
    automated match to d1hkxd_

Details for d2f86d_

PDB Entry: 2f86 (more details), 2.64 Å

PDB Description: the association domain of c. elegans camkii
PDB Compounds: (D:) Hypothetical protein K11E8.1d

SCOPe Domain Sequences for d2f86d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f86d_ d.17.4.0 (D:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndsekaqkqdivrvtqtlldaisckdfetytrlcdtsmtcfepealgnliegiefhrfyf
dgnrknqvhttmlnpnvhiigedaacvayvkltqfldrngeahtrqsqesrvwskkqgrw
vcvhvhrst

SCOPe Domain Coordinates for d2f86d_:

Click to download the PDB-style file with coordinates for d2f86d_.
(The format of our PDB-style files is described here.)

Timeline for d2f86d_: